PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0093s0260.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 331aa    MW: 37672.4 Da    PI: 4.8018
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0093s0260.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.63.3e-5561331128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                             lppGfrFhPtdeelvv+yL +k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf s+rdkky++g+r+nratk+gyWka
  SapurV1A.0093s0260.1.p   6 LPPGFRFHPTDEELVVYYLDRKINGRTVEL-EIIPEVDLYKCEPWDLPeKsFLPSKDLEWYFLSPRDKKYPNGSRTNRATKAGYWKA 91 
                             79*************************999.99**************95334455777***************************** PP

                     NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             tgkd++v s +++ vg+kktLv+y+grap+g +t+Wvmheyrl
  SapurV1A.0093s0260.1.p  92 TGKDRPVSS-QKRPVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                             ********9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-634157IPR003441NAC domain
PROSITE profilePS5100559.9636157IPR003441NAC domain
PfamPF023658.7E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV VYYLDRKING RTVELEIIPE VDLYKCEPWD LPEKSFLPSK  60
DLEWYFLSPR DKKYPNGSRT NRATKAGYWK ATGKDRPVSS QKRPVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLIDSLCGA ASSSLKDSYA LCRVFKKTIH IPKPKEEENN GNDREKDAAA  180
VSEVQLLGDD TVSGIESSKG RDNADHRDEN FNNGYCKFPS ETSSSDVTQG TPIETAMPDD  240
LQPPFPSDEA ISSASLYSMG VDFSSNLIQD MQMPNCWSLQ YQFPFPPLEL KDFPQIGFTE  300
GMEPSKPEII DDYMMYRDCM NGIFEENFYL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-58115712165NO APICAL MERISTEM PROTEIN
1ut4_B3e-58115712165NO APICAL MERISTEM PROTEIN
1ut7_A3e-58115712165NO APICAL MERISTEM PROTEIN
1ut7_B3e-58115712165NO APICAL MERISTEM PROTEIN
3swm_A4e-58115715168NAC domain-containing protein 19
3swm_B4e-58115715168NAC domain-containing protein 19
3swm_C4e-58115715168NAC domain-containing protein 19
3swm_D4e-58115715168NAC domain-containing protein 19
3swp_A4e-58115715168NAC domain-containing protein 19
3swp_B4e-58115715168NAC domain-containing protein 19
3swp_C4e-58115715168NAC domain-containing protein 19
3swp_D4e-58115715168NAC domain-containing protein 19
4dul_A3e-58115712165NAC domain-containing protein 19
4dul_B3e-58115712165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1878611e-112AC187861.2 Populus trichocarpa clone Pop1-1A4, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316156.10.0hypothetical protein POPTR_0010s18180g
SwissprotQ9FFI53e-91NAC86_ARATH; NAC domain-containing protein 86
TrEMBLB9HYC20.0B9HYC2_POPTR; Uncharacterized protein
STRINGPOPTR_0010s18180.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-102NAC domain containing protein 20